PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G293800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 313aa    MW: 33087.4 Da    PI: 7.5241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G293800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.9e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+lv++++ +G g+W++++r  g+ R++k+c++rw +yl
  Sevir.5G293800.2.p 14 RGLWSPEEDEKLVKYITTHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61
                        788*******************************************97 PP

2Myb_DNA-binding52.61e-1667110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+ l+vd+++ lG++ W+ Ia++++ gRt++++k++w++
  Sevir.5G293800.2.p  67 RGSFSQQEEALIVDLHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                         899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.501961IPR017930Myb domain
SuperFamilySSF466894.87E-2912108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002497.3E-161461IPR001005SANT/Myb domain
CDDcd001674.76E-121761No hitNo description
PROSITE profilePS5129425.97462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2565117IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002499.0E-1567110IPR001005SANT/Myb domain
CDDcd001678.23E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT THGHGCWSSV PRQAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEEALIVD LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VGSLHPDLYY NILDGAGQGI AVAGCAPLSG ADNASAQAAT VSAQSPPPML HNPAAAWADF  180
VSQPLFLPGN NGVHGGGDGL HEYAVDGEFI KLCRAADAFP PPESGVAGVA ANQCKPADLL  240
AQQEGAAAAV RSLPVFLEPK GGTGTLAADP AMGPVMDFME AILGSSSTSA VSASSVDSFS  300
ANTGMQAHCW IP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9587340.0EU958734.1 Zea mays clone 1711992 MYB9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969714.10.0PREDICTED: transcription factor MYB86-like isoform X2
TrEMBLK3XK960.0K3XK96_SETIT; Uncharacterized protein
STRINGSi002319m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.28e-76myb domain protein 26